Chemical Peptide Teriparatide Acetate CAS 52232-67-4 Powder

• CAS No.: 52232-67-4
• Formula: C172h278n52o47s2
• EINECS: 640-978-1
• Type: Pharmaceutical Intermediates
• Appearance: Powder
• Quality: Industrial
• Model NO.: 52232-67-4
• Colour: White
• Transport Package: Customer Selection
• Specification: 5/10/15/20/50/100mg
• Trademark: VKESN
• Origin: China
• Production Capacity: 99999

Product Description

Product Description

Chemical Peptide Teriparatide Acetate CAS 52232-67-4 powder
 

Name:Teriparatide Acetate
Type:GMP peptides
CAS.NO:52232-67-4
Single Impurity(HPLC):2.0%
Peptide Content(N%):80%(by %N)
Acid content(HPLC):15.0%
Mass balance:95.0~105.0%
MW :4117.72
Formula :C181H291N55O51S2
EINECS: 640-978-1
Purity(HPLC):95.0%
Appearance:White powder

 

Product Parameters

 

English name	Teriparatide Acetate
Cas number	52232-67-4
Synonyms	PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Purity	99%
delivery	8-12days
Delivery time	Next day of payment
Mode of transport	Sea, air and truck transport
Express delivery	EMS,UPS,FedEx,DHL,TNT

USES: A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors

Packaging & Shipping

 

Company Profile

Hebei VKESN Technology Co., Ltd. is  located in the chemical production base in Hebei Province. It is a large-scale biotechnology enterprise integrating production, processing and sales. Our company is a hi-tech enterprise integrating R & D, production, agency and sales of chemicals such as inorganic chemicals, organic chemicals, flavors and fragrances, detergent raw materials and cosmetic raw materials. We have established long-term cooperation with many large group companies at home and abroad. The company has strong technical force, advanced technology and production equipment, perfect product quality assurance system, scientific management methods and professional technical personnel, which determine the superior quality of products. In today's rapid development, we have been seizing the opportunity, adhering to the enterprise tenet of "quality is life, integrity is soul", and determined to build the enterprise into a first-class chemical group company in China. We are willing to sincerely cooperate with the new and old customers, hand in hand, create a win-win future.

FAQ

1. Are you a manufacturer?
---- Yes , we own factory and have rich experience to provide professional solutions .
2. Can you do customization?
---- Yes , We accept client's requests of OEM & ODM, can do customized logo on products body or package with your own brand names,also we can do private label stick on each package.
3. How to make an order?
---- Please send us your email, receiving address and contact phone number, then order request link would be sent to you to check and make the payment.
4. What is your payment terms and payment methods?
---- Payment can be done via T/T, western union or PayPal.
5. What is your terms of delivery?
---- We accept EXW, FOB, CIF, etc. You can choose the one which is the most convenient or cost effective for you.